PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr9P21040_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family bZIP
Protein Properties Length: 194aa    MW: 21640.3 Da    PI: 10.8596
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr9P21040_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.72.9e-14123175557
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                            +r +r++kNRe+A rsR+RK+a+  eLe +++ L +eN++Lk e e+l+ +va
  GSMUA_Achr9P21040_001 123 QRKKRMIKNRESAARSRARKQAYRNELELEAARLLNENEMLKRESEQLRMTVA 175
                            699*********************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-10119183IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.139121171IPR004827Basic-leucine zipper domain
PfamPF001702.2E-11123175IPR004827Basic-leucine zipper domain
CDDcd147075.12E-21123177No hitNo description
SuperFamilySSF579591.38E-9124171No hitNo description
Gene3DG3DSA:1.20.5.1701.2E-11124175No hitNo description
PROSITE patternPS000360126141IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MPGRNMEEVW KDISLSTLHQ DVPSTPVLAF HPATTISSFR AVMLQDFIAD AFKAENRAPP  60
PSTHSPPASL SPTSDNSRQF FGYDLNASAS ASGSNAAQSE STKKRSPEKR PNRSVDRQSG  120
VEQRKKRMIK NRESAARSRA RKQAYRNELE LEAARLLNEN EMLKRESEQL RMTVAAQNPT  180
ASKPTLQRTL TAPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009418350.11e-140PREDICTED: protein FD-like
TrEMBLM0U2631e-140M0U263_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P21040_0011e-140(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP97643044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.17e-15bZIP family protein